PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn171061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 477aa    MW: 52674.2 Da    PI: 7.156
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn171061genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285e-096088130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     r rWT+eE++++++a k++G   W++I  +
       Achn171061 60 RERWTEEEHKKFIEALKLYGRA-WRRIEVH 88
                     78******************88.***9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-65487IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-75887IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-56088IPR009057Homeodomain-like
PfamPF002493.1E-66087IPR001005SANT/Myb domain
CDDcd001675.94E-46285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAIQDHSGGT ESNAVLPKGN SNLVDVGVSC VKGGQLKEQF PSGNDFSLKV RKPYTITKQR  60
ERWTEEEHKK FIEALKLYGR AWRRIEVHIF YILLYAYAVS FQVVRESSTS DVDSLKPIEI  120
PPPRPKRKPM HPYPRKVVAS LKTGPSVPEQ RRRSTSPNLS VSEQDNQSPT SVLTAFGSET  180
LGTADSNSPN GSLSPISSAA GVNPGNFFNE PNSFPEETAS PLLVQLTACS SPDEQVNEHV  240
AMKLELFPKD TAVVKEGPAE VAYPQSLKLF GKTVLVTDSH RPSSPTTGNC KSLPSDTAHA  300
LPWNSIPADF SSKDRKGTWN PLASRARAAL YCMQFQNGNS NPEYDGPGPC LPLLPFYGDM  360
QFPCFPMPNQ VSEKENPLYC SGHTEDSEVQ KEGSWTGSNS GSVNVGDKNW EAETRSCFLS  420
LDKKENEYQL ELLRKPSPGK PLKGFVPYKR CLAERDTQSL AIFSEEREEQ RVRLCL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267976.21e-137PREDICTED: protein REVEILLE 1
TrEMBLA5C7G81e-134A5C7G8_VITVI; Putative uncharacterized protein
STRINGVIT_04s0079g00410.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.16e-49MYB_related family protein